Abnova™ Human IL17E Full-length ORF (NP_073626.1, 1 a.a. - 177 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Catalog Number	Mfr. No.	Quantity
89-948-846	Abnova™ H00064806P01L	25 ug
89-948-845	Abnova™ H00064806P01S	10 ug

Description

The protein encoded by this gene is a cytokine that shares the sequence similarity with IL17. This cytokine can induce NF-kappaB activation, and stimulate the production of IL8. Both this cytokine and IL17B are ligands for the cytokine receptor IL17BR. Studies of the similar gene in mice suggested that this cytokine may be a proinflammatory cytokine favoring Th2-type immune response. Two alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported. [provided by RefSeq]

Sequence: MRERPRLGEDSSLISLFLQVVAFLAMVMGTHTYSHWPSCCPSKGQDTSEELLRWSTVPVPPLEPARPNRHPESCRASEDGPLNSRAISPWRYELDRDLNRLPQDLYHARCLCPHCVSLQTGSHMDPRGNSELLYHNQTVFYRRPCHGEKGTHKGYCLERRLYRVSLACVCVRPRVMG

Specifications

• Accession Number: NP_073626.1
• Format: Liquid
• Gene ID (Entrez): 64806
• Name: IL17E (Human) Recombinant Protein (P01)
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Gene Alias: IL-17E/IL-25/IL17E
• Gene Symbol: IL25
• Recombinant: Yes
• Expression System: wheat germ expression system

• For Use With (Application): Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Weight: 46.7kDa
• Purification Method: Glutathione Sepharose 4 Fast Flow
• Immunogen: MRERPRLGEDSSLISLFLQVVAFLAMVMGTHTYSHWPSCCPSKGQDTSEELLRWSTVPVPPLEPARPNRHPESCRASEDGPLNSRAISPWRYELDRDLNRLPQDLYHARCLCPHCVSLQTGSHMDPRGNSELLYHNQTVFYRRPCHGEKGTHKGYCLERRLYRVSLACVCVRPRVMG
• Regulatory Status: RUO
• Common Name: IL25
• Host Species: Wheat Germ (in vitro)
• Protein Tag: GST