Abnova™ Human IL29 (Q8IU54, 24 a.a. - 200 a.a.) Partial Recombinant Protein

Used for Func, SDS-PAGE

Supplier:  Abnova™ P3635

Catalog No. 89-948-864

Description

This gene encodes a cytokine distantly related to type I interferons and the IL-10 family. This gene, interleukin 28A (IL28A), and interleukin 28B (IL28B) are three closely related cytokine genes that form a cytokine gene cluster on a chromosomal region mapped to 19q13. Expression of the cytokines encoded by the three genes can be induced by viral infection. All three cytokines have been shown to interact with a heterodimeric class II cytokine receptor that consists of interleukin 10 receptor, beta (IL10RB) and interleukin 28 receptor, alpha (IL28RA). [provided by RefSeq]

Sequence: TSKPTTTGKGCHIGRFKSLSPQELASFKKARDALEESLKLKNWSCSSPVFPGNWDLRLLQVRERPVALEAELALTLKVLEAAAGPALEDVLDQPLHTLHHILSQLQACIQPQPTAGPRPRGRLHHWLHRLQEAPKKESAGCLEASVTFNLFRLLTRDLKYVADGNLCLRTSTHPEST

Specifications

• Accession Number: Q8IU54
• Formulation: Lyophilized
• Molecular Weight (g/mol): 20kDa
• Preparation Method: Escherichia coli expression system
• Quantity: 20 ug
• Storage Requirements: Store at -20°C on dry atmosphere for 2 years. After reconstitution with deionized water, store at 4°C for 1 month or store at -20°C for 6 months. Aliquot to avoid repeated freezing and thawing.
• Endotoxin Concentration: <0.1ng/μg (1 EU/μg)
• Common Name: IL29
• Biological Activity: The ED50 is determined in an anti-viral assay using human HepG2 cells infected with EMCV is typically 1-5ng/mL.
• Recombinant: Recombinant
• Expression System: Escherichia coli expression system
• Purity or Quality Grade: >90% by SDS-PAGE and HPLC

• For Use With (Application): Functional Study, SDS-PAGE
• Gene ID (Entrez): 282618
• Name: IL29 (Human) Recombinant Protein
• Purification Method: Ion exchange column and HPLC reverse phase column
• Immunogen: TSKPTTTGKGCHIGRFKSLSPQELASFKKARDALEESLKLKNWSCSSPVFPGNWDLRLLQVRERPVALEAELALTLKVLEAAAGPALEDVLDQPLHTLHHILSQLQACIQPQPTAGPRPRGRLHHWLHRLQEAPKKESAGCLEASVTFNLFRLLTRDLKYVADGNLCLRTSTHPEST
• Regulatory Status: RUO
• Gene Alias: IFNL1/IL-29
• Gene Symbol: IL29
• Species: E. coli
• Protein Tag: None
• Form: Lyophilized