Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Abnova™ Human IL29 (Q8IU54, 24 a.a. - 200 a.a.) Partial Recombinant Protein

Used for Func, SDS-PAGE

Manufacturer:  Abnova™ P3635

Catalog No. 89-948-864


Add to cart

Description

Description

This gene encodes a cytokine distantly related to type I interferons and the IL-10 family. This gene, interleukin 28A (IL28A), and interleukin 28B (IL28B) are three closely related cytokine genes that form a cytokine gene cluster on a chromosomal region mapped to 19q13. Expression of the cytokines encoded by the three genes can be induced by viral infection. All three cytokines have been shown to interact with a heterodimeric class II cytokine receptor that consists of interleukin 10 receptor, beta (IL10RB) and interleukin 28 receptor, alpha (IL28RA). [provided by RefSeq]

Sequence: TSKPTTTGKGCHIGRFKSLSPQELASFKKARDALEESLKLKNWSCSSPVFPGNWDLRLLQVRERPVALEAELALTLKVLEAAAGPALEDVLDQPLHTLHHILSQLQACIQPQPTAGPRPRGRLHHWLHRLQEAPKKESAGCLEASVTFNLFRLLTRDLKYVADGNLCLRTSTHPEST
Specifications

Specifications

Q8IU54
Functional Study, Sodium Dodecyl Sulfate–Polyacrylamide Gel Electrophoresis
Lyophilized
20kDa
Escherichia coli expression system
>90% by SDS-PAGE and HPLC
TSKPTTTGKGCHIGRFKSLSPQELASFKKARDALEESLKLKNWSCSSPVFPGNWDLRLLQVRERPVALEAELALTLKVLEAAAGPALEDVLDQPLHTLHHILSQLQACIQPQPTAGPRPRGRLHHWLHRLQEAPKKESAGCLEASVTFNLFRLLTRDLKYVADGNLCLRTSTHPEST
RUO
IFNL1|IL-29
IL29
Escherichia coli
None
Escherichia coli expression system
Lyophilized
282618
IL29 (Human) Recombinant Protein
Ion exchange column and HPLC reverse phase column
20 ug
Store at -20°C on dry atmosphere for 2 years. After reconstitution with deionized water, store at 4°C for 1 month or store at -20°C for 6 months. Aliquot to avoid repeated freezing and thawing.
<0.1ng/μg (1 EU/μg)
IL29
The ED50 is determined in an anti-viral assay using human HepG2 cells infected with EMCV is typically 1-5ng/mL.
Yes
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit