Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Abnova™ Human IL4 (NP000580, 25 a.a. - 153 a.a.) Partial Recombinant Protein with His tag

Used for Func, SDS-PAGE

Manufacturer:  Abnova™ P3477

Catalog No. 89-948-909


Add to cart

Description

Description

The protein encoded by this gene is a pleiotropic cytokine produced by activated T cells. This cytokine is a ligand for interleukin 4 receptor. The interleukin 4 receptor also binds to IL13, which may contribute to many overlapping functions of this cytokine and IL13. STAT6, a signal transducer and activator of transcription, has been shown to play a central role in mediating the immune regulatory signal of this cytokine. This gene, IL3, IL5, IL13, and CSF2 form a cytokine gene cluster on chromosome 5q, with this gene particularly close to IL13. This gene, IL13 and IL5 are found to be regulated coordinately by several long-range regulatory elements in an over 120 kilobase range on the chromosome. Two alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported. [provided by RefSeq]

Sequence: MGSSHHHHHHSSGLVPRGSHMHKCDITLQEIIKTLNSLTEQKTLCTELTVTDIFAASKNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCSS
Specifications

Specifications

Escherichia coli expression system
0.5 mg/mL
Liquid
3565
IL4 (Human) Recombinant Protein
Conventional Chromatography
Loading 3 ug protein in 15% SDS-PAGE
MGSSHHHHHHSSGLVPRGSHMHKCDITLQEIIKTLNSLTEQKTLCTELTVTDIFAASKNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCSS
RUO
BCGF-1|BCGF1|BSF1|IL-4|MGC79402
IL4
Escherichia coli
His
NP000580
Functional Study, Sodium Dodecyl Sulfate–Polyacrylamide Gel Electrophoresis
Liquid
17.2kDa
Escherichia coli expression system
>95% by SDS-PAGE
50 ug
Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C. Aliquot to avoid repeated freezing and thawing.
<1.0 EU/μg of protein (determined by LAL method)
IL4
The ED50 for this effect is <1.8ng/mL. Measured in a cell proliferation assay using TF1 human erythroleukemic cells.
Yes
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit