Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Abnova™ Human ITM1 Partial ORF (NP_689926, 603 a.a. - 701 a.a.) Recombinant Protein with GST-tag at N-terminal

Name: Abnova&trade; Human ITM1 Partial ORF (NP_689926, 603 a.a. - 701 a.a.) Recombinant Protein with GST-tag at N-terminal
Brand: Abnova&trade;
SKU: p-7094849

Used for AP, Array, ELISA, WB-Re

$499.00 - $769.00

Specifications

Accession Number	NP_689926
For Use With (Application)	Antibody Production, ELISA, Protein Array, Western Blot
Formulation	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID (Entrez)	3703
Molecular Weight (g/mol)	36.63kDa

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
89-949-352 View Documents View Product Certificates	Abnova™ H00003703Q01S	10 ug	Each for $499.00		Add to Cart

89-949-353 View Documents View Product Certificates	Abnova™ H00003703Q01L	25 ug	Each for $769.00		Add to Cart

Description

Sequence: GGSTDTGKHIKENDYYTPTGEFRVDREGSPVLLNCLMYKMCYYRFGQVYTEAKRPPGFDRVRNAEIGNKDFELDVLEEAYTTEHWLVRIYKVKDLDNRG

Specifications

Accession Number	NP_689926
Formulation	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Weight (g/mol)	36.63kDa
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Alias	FLJ27038/ITM1/MGC9042/STT3-A/TMC
Gene Symbol	STT3A
Recombinant	Recombinant
Expression System	wheat germ expression system

For Use With (Application)	Antibody Production, ELISA, Protein Array, Western Blot
Gene ID (Entrez)	3703
Name	ITM1 (Human) Recombinant Protein (Q01)
Immunogen	GGSTDTGKHIKENDYYTPTGEFRVDREGSPVLLNCLMYKMCYYRFGQVYTEAKRPPGFDRVRNAEIGNKDFELDVLEEAYTTEHWLVRIYKVKDLDNRG
Regulatory Status	RUO
Common Name	STT3A
Species	Wheat Germ (in vitro)
Protein Tag	GST
Form	Liquid

Spot an opportunity for improvement?

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

Full Name:

Email Address:*

User Name:

Telephone Number:

What type of issue did you experience with the content on the page?*

Please provide a detailed description of the issue or request*

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Abnova™ Human ITM1 Partial ORF (NP_689926, 603 a.a. - 701 a.a.) Recombinant Protein with GST-tag at N-terminal

Specifications

Description

Specifications

Documents