Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Abnova™ Human KIAA1143 Full-length ORF (NP_065747.1, 1 a.a. - 154 a.a.) Recombinant Protein with GST-tag at N-terminal

Name: Abnova&trade; Human KIAA1143 Full-length ORF (NP_065747.1, 1 a.a. - 154 a.a.) Recombinant Protein with GST-tag at N-terminal
Brand: Abnova&trade;
SKU: 89-949-752
Price: 487.50 USD

Used for AP, Array, ELISA, WB-Re

Supplier: Abnova™ H00057456P01S

View more versions of this product

Catalog No. 89-949-752

$487.50 / Each of 1

Qty

Add to Cart

Description

Sequence: MSKRNQVSYVRPAEPAFLARFKERVGYREGPTVETKRIQPQPPDEDGDHSDKEDEQPQVVVLKKGDLSVEEVMKIKAEIKAAKADEEPTPADGRIIYRKPVKHPSDEKYSGLTASSKKKKPNEDEVNQDSVKKNSQKQIKNSSLLSFDNEDENE

Specifications

Accession Number	NP_065747.1
Formulation	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Weight (g/mol)	43.9kDa
Purification Method	Glutathione Sepharose 4 Fast Flow
Quantity	10 ug
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Common Name	KIAA1143
Species	Wheat Germ (in vitro)
Protein Tag	GST
Form	Liquid

For Use With (Application)	Antibody Production, Protein Array, ELISA, Western Blot
Gene ID (Entrez)	57456
Name	KIAA1143 (Human) Recombinant Protein (P01)
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Immunogen	MSKRNQVSYVRPAEPAFLARFKERVGYREGPTVETKRIQPQPPDEDGDHSDKEDEQPQVVVLKKGDLSVEEVMKIKAEIKAAKADEEPTPADGRIIYRKPVKHPSDEKYSGLTASSKKKKPNEDEVNQDSVKKNSQKQIKNSSLLSFDNEDENE
Regulatory Status	RUO
Gene Symbol	KIAA1143
Recombinant	Recombinant
Expression System	wheat germ expression system

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

Full Name:

Email Address:*

User Name:

Telephone Number:

What type of issue did you experience with the content on the page?*

Please provide a detailed description of the issue or request*

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Provide Content Correction

Welcome to fishersci.com

Abnova™ Human KIAA1143 Full-length ORF (NP_065747.1, 1 a.a. - 154 a.a.) Recombinant Protein with GST-tag at N-terminal

Description

Specifications

Documents

Promotions