Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Abnova™ Human KLK13 Partial ORF (NP_056411.1, 179 a.a. - 277 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

$460.50 - $709.50

Specifications

Name KLK13 (Human) Recombinant Protein (Q01)
Recombinant Yes
For Use With (Application) Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
Molecular Weight 36.63kDa
Storage Requirements Store at -80°C. Aliquot to avoid repeated freezing and thawing.
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
89-950-079
View Documents
Abnova™
H00026085Q01S
10 ug
Each for $460.50
Add to cart
 
89-950-080
View Documents
Abnova™
H00026085Q01L
25 ug
Each for $709.50
Add to cart
 
Description

Description

Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. Expression of this gene is regulated by steroid hormones and may be useful as a marker for breast cancer. An additional transcript variant has been identified, but its full length sequence has not been determined. [provided by RefSeq]

Sequence: ANIQLRSDEECRQVYPGKITDNMLCAGTKEGGKDSCEGDSGGPLVCNRTLYGIVSWGDFPCGQPDRPGVYTRVSRYVLWIRETIRKYETQQQKWLKGPQ
Specifications

Specifications

KLK13 (Human) Recombinant Protein (Q01)
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Yes
36.63kDa
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit