Abnova™ Human LILRB2 Full-length ORF (AAH41708.1) Recombinant Protein without tag

Used for AP, Func, Screening

Supplier:  Abnova™ H00010288G01

Catalog No. 89-950-687

Description

This gene is a member of the leukocyte immunoglobulin-like receptor (LIR) family, which is found in a gene cluster at chromosomal region 19q13.4. The encoded protein belongs to the subfamily B class of LIR receptors which contain two or four extracellular immunoglobulin domains, a transmembrane domain, and two to four cytoplasmic immunoreceptor tyrosine-based inhibitory motifs (ITIMs). The receptor is expressed on immune cells where it binds to MHC class I molecules on antigen-presenting cells and transduces a negative signal that inhibits stimulation of an immune response. It is thought to control inflammatory responses and cytotoxicity to help focus the immune response and limit autoreactivity. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Sequence: MTPALTALLCLGLSLGPRTRVQAGPFPKPTLWAEPGSVISWGSPVTIWCQGSLEAQEYQLDKEGSPEPLDRNNPLEPKNKARFSIPSMTQHHAGRYRCHYYSSAGWSEPSDPLELVMTGFYNKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSGGFQALFPVGPVTPSHRRV

Specifications

• Accession Number: AAH41708.1
• Formulation: Liquid
• Molecular Weight (g/mol): 21.2kDa
• Quantity: 10 ug
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Gene Alias: CD85D/ILT4/LILRA6/LIR-2/LIR2/MIR-10/MIR10
• Gene Symbol: LILRB2
• Recombinant: Recombinant
• Expression System: wheat germ expression system with proprietary liposome technology

• For Use With (Application): Antibody Production, Compound Screening, Functional Study
• Gene ID (Entrez): 10288
• Name: LILRB2 (Human) Recombinant Protein
• Immunogen: MTPALTALLCLGLSLGPRTRVQAGPFPKPTLWAEPGSVISWGSPVTIWCQGSLEAQEYQLDKEGSPEPLDRNNPLEPKNKARFSIPSMTQHHAGRYRCHYYSSAGWSEPSDPLELVMTGFYNKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSGGFQALFPVGPVTPSHRRV
• Regulatory Status: RUO
• Common Name: LILRB2
• Species: Wheat Germ (in vitro)
• Protein Tag: None
• Form: Liquid