Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Abnova™ Human LIN28 (Q9H9Z2) Full-length Recombinant Protein

Used for Func, SDS-PAGE

Manufacturer:  Abnova™ P6110

Catalog No. 89-950-713


Add to cart

Description

Description

Sequence: GPSVSNQQFAGGCAKAAEEAPEEAPEDAARAADEPQLLHGAGICKWFNVRMGFGFLSMTARAGVALDPPVDVFVHQSKLHMEGFRSLKEGEAVEFTFKKSAKGLESIRVTGPGGVFCIGSERRPKGKSMQKRRSKGDRCYNCGGLDHHAKECKLPPQPKKCHFCQSISHMVASCPLKAQQGP
Specifications

Specifications

Q9H9Z2
Functional Study, Sodium Dodecyl Sulfate–Polyacrylamide Gel Electrophoresis
Lyophilized
24.4kDa
E. coli expression system
25 ug
Store at -20°C. Reconstitute in water to a concentration of 1.0 mg/mL. Do not vortex. For extended storage, it is recommended to be further diluted in buffer containing carrier protein (e.g. 0.1% BSA) and stored in aliquots at -20°C to -80°C.
<0.1ng/μg (<1 EU/μg)
LIN28
Measured by its ability to induce fluorescence in Lin28 reporter cells (293 cells transfected with fluorescent protein genes under Lin28 control). OptimμM activity was achieved at 20μg/ml after incubation for 72 hr.
Escherichia coli
None
E. coli expression system
Lyophilized
79727
LIN28 (Human) Recombinant Protein
0.9
GPSVSNQQFAGGCAKAAEEAPEEAPEDAARAADEPQLLHGAGICKWFNVRMGFGFLSMTARAGVALDPPVDVFVHQSKLHMEGFRSLKEGEAVEFTFKKSAKGLESIRVTGPGGVFCIGSERRPKGKSMQKRRSKGDRCYNCGGLDHHAKECKLPPQPKKCHFCQSISHMVASCPLKAQQGP
RUO
CSDD1|FLJ12457|LIN-28|LIN28A|ZCCHC1
LIN28
Human ;Human
Yes
SDS
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit