Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Abnova™ Human LRP12 Full-length ORF (-, 1 a.a. - 129 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

$460.50 - $709.50

Specifications

Name LRP12 (Human) Recombinant Protein (P01)
Recombinant Yes
Purification Method Glutathione Sepharose 4 Fast Flow
For Use With (Application) Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
Molecular Weight 39.93kDa
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
89-963-401
View Documents
Abnova™
H00029967P01S
10 ug
Each for $460.50
Add to cart
 
89-963-402
View Documents
Abnova™
H00029967P01L
25 ug
Each for $709.50
Add to cart
 
Description

Description

This gene was identified by its differential expression in cancer cells. The product of this gene is predicted to be a transmembrane protein. The level of this protein was found to be lower in tumor derived cell lines compared to normal cells. This gene was thus proposed to be a candidate tumor suppressor gene. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Sequence: MKIFYYALNLELYKTCTKIVQDKFHLVMSFPNTGLRLHWTLGICTKIISRSQMSLVHKHYHFKYYYLLPQQLYISIAFGWGRGTFLLQLEIALLVSYLFVVFKKYIVVRVIFSIYFIPGGDHATLSKEN
Specifications

Specifications

LRP12 (Human) Recombinant Protein (P01)
Glutathione Sepharose 4 Fast Flow
39.93kDa
Yes
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit