Abnova™ Human MAGEA5 Partial ORF (NP_066387.1, 60 a.a. - 124 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Catalog Number	Mfr. No.	Quantity
89-951-446	Abnova™ H00004104Q01L	25 ug
89-951-445	Abnova™ H00004104Q01S	10 ug

Description

This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita. [provided by RefSeq]

Sequence: GPLKSPQGASAIPTAIDFTLWRQSIKGSSNQEEEGPSTSPDPESVFRAALSKKVADLIHFLLLKY

Specifications

• Accession Number: NP_066387.1
• Format: Liquid
• Gene ID (Entrez): 4104
• Name: MAGEA5 (Human) Recombinant Protein (Q01)
• Immunogen: GPLKSPQGASAIPTAIDFTLWRQSIKGSSNQEEEGPSTSPDPESVFRAALSKKVADLIHFLLLKY
• Regulatory Status: RUO
• Common Name: MAGEA5
• Host Species: Wheat Germ (in vitro)
• Protein Tag: GST

• For Use With (Application): Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Weight: 32.89kDa
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Gene Alias: MAGE5/MAGEA4/MGC129526
• Gene Symbol: MAGEA5
• Recombinant: Yes
• Expression System: wheat germ expression system