Learn More
Abnova™ Human MAPK13 Partial ORF (AAH00433, 251 a.a. - 365 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Manufacturer: Abnova™ H00005603Q01L
Description
The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. This kinase is closely related to p38 MAP kinase, both of which can be activated by proinflammatory cytokines and cellular stress. MAP kinase kinases 3, and 6 can phosphorylate and activate this kinase. Transcription factor ATF2, and microtubule dynamics regulator stathmin have been shown to be the substrates of this kinase. [provided by RefSeq]
Sequence: NDKAAKSYIQSLPQTPRKDFTQLFPRASPQAADLLEKMLELDVDRRLTAAQALTHPFFEPFRDPEEETEAQQPFDDSLEHEKLTVDEWKQHIYKEIVNFSPIARKDSRRRSGMKLSpecifications
AAH00433 | |
Liquid | |
5603 | |
MAPK13 (Human) Recombinant Protein (Q01) | |
25 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
MGC99536/PRKM13/SAPK4/p38delta | |
MAPK13 | |
Yes | |
wheat germ expression system |
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
38.28kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
NDKAAKSYIQSLPQTPRKDFTQLFPRASPQAADLLEKMLELDVDRRLTAAQALTHPFFEPFRDPEEETEAQQPFDDSLEHEKLTVDEWKQHIYKEIVNFSPIARKDSRRRSGMKL | |
RUO | |
MAPK13 | |
Wheat Germ (in vitro) | |
GST |
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.