Learn More
Abnova™ Human MED8 Partial ORF (NP_443109, 1 a.a. - 59 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Manufacturer: Abnova™ H00112950Q01L
Description
This gene encodes a protein that is one of more than 20 subunits of the mediator complex, first identified in S. cerevisiae, that is required for activation of transcription. The product of this gene also interacts with elongins B and C, and CUL2 and RBX1, to reconstitute a ubiquitin ligase. Two alternative transcripts encoding different isoforms have been described. [provided by RefSeq]
Sequence: MRQTEGRVPVFSHEVVPDHLRTKPDPEVEEQEKQLTTDAARIGADAAQKQIQSLNKMCSSpecifications
wheat germ expression system | |
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
32.23kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
MRQTEGRVPVFSHEVVPDHLRTKPDPEVEEQEKQLTTDAARIGADAAQKQIQSLNKMCS | |
RUO | |
MED8 | |
Wheat Germ (in vitro) | |
GST |
NP_443109 | |
Liquid | |
112950 | |
MED8 (Human) Recombinant Protein (Q01) | |
25 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
ARC32/MGC17544/MGC19641 | |
MED8 | |
Yes |
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.