Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Abnova™ Human MKRN2 Full-length ORF (NP_054879.3, 1 a.a. - 416 a.a.) Recombinant Protein with GST-tag at N-terminal

Name: Abnova&trade; Human MKRN2 Full-length ORF (NP_054879.3, 1 a.a. - 416 a.a.) Recombinant Protein with GST-tag at N-terminal
Brand: Abnova&trade;
SKU: 89-952-571
Price: 769.00 USD

Used for AP, Array, ELISA, WB-Re

Supplier: Abnova™ H00023609P01L

View more versions of this product

Catalog No. 89-952-571

$769.00 / Each of 1

Qty

Add to Cart

Description

Members of the makorin family, including MKRN2, have a characteristic zinc finger composition that suggests that they are ribonucleoproteins (Gray et al., 2001 [PubMed 11597136]).[supplied by OMIM]

Sequence: MSTKQITCRYFMHGVCREGSQCLFSHDLANSKPSTICKYYQKGYCAYGTRCRYDHTRPSAAAGGAVGTMAHSVPSPAFHSPHPPSEVTASIVKTNSHEPGKREKRTLVLRDRNLSGMAERKTQPSMVSNPGSCSDPQPSPEMKPHSYLDAIRSGLDDVEASSSYSNEQQLCPYAAAGECRFGDACVYLHGEVCEICRLQVLHPFDPEQRKAHEKICMLTFEHEMEKAFAFQASQDKVCSICMEVILEKASASERRFGILSNCNHTYCLSCIRQWRCAKQFENPIIKSCPECRVISEFVIPSVYWVEDQNKKNELIEAFKQGMGKKACKYFEQGKGTCPFGSKCLYRHAYPDGRLAEPEKPRKQLSSQGTVRFFNSVRLWDFIENRESRHVPNNEDVDMTELGDLFMHLSGVESSEP

Specifications

Accession Number	NP_054879.3
Formulation	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Weight (g/mol)	73.3kDa
Purification Method	Glutathione Sepharose 4 Fast Flow
Quantity	25 ug
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Alias	HSPC070/RNF62
Gene Symbol	MKRN2
Recombinant	Recombinant
Expression System	wheat germ expression system

For Use With (Application)	Antibody Production, Protein Array, ELISA, Western Blot
Gene ID (Entrez)	23609
Name	MKRN2 (Human) Recombinant Protein (P01)
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Immunogen	MSTKQITCRYFMHGVCREGSQCLFSHDLANSKPSTICKYYQKGYCAYGTRCRYDHTRPSAAAGGAVGTMAHSVPSPAFHSPHPPSEVTASIVKTNSHEPGKREKRTLVLRDRNLSGMAERKTQPSMVSNPGSCSDPQPSPEMKPHSYLDAIRSGLDDVEASSSYSNEQQLCPYAAAGECRFGDACVYLHGEVCEICRLQVLHPFDPEQRKAHEKICMLTFEHEMEKAFAFQASQDKVCSICMEVILEKASASERRFGILSNCNHTYCLSCIRQWRCAKQFENPIIKSCPECRVISEFVIPSVYWVEDQNKKNELIEAFKQGMGKKACKYFEQGKGTCPFGSKCLYRHAYPDGRLAEPEKPRKQLSSQGTVRFFNSVRLWDFIENRESRHVPNNEDVDMTELGDLFMHLSGVESSEP
Regulatory Status	RUO
Common Name	MKRN2
Species	Wheat Germ (in vitro)
Protein Tag	GST
Form	Liquid

Product Suggestions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

Full Name:

Email Address:*

User Name:

Telephone Number:

What type of issue did you experience with the content on the page?*

Please provide a detailed description of the issue or request*

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Spot an opportunity for improvement?

Provide Content Correction

Abnova™ Human MKRN2 Full-length ORF (NP_054879.3, 1 a.a. - 416 a.a.) Recombinant Protein with GST-tag at N-terminal

Description

Specifications

Product Suggestions

Documents

Promotions