Abnova™ Human MS4A6A Full-length ORF (AAH22854, 1 a.a. - 248 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Supplier:  Abnova™ H00064231P01S

Catalog No. 89-953-011

Description

This gene encodes a member of the membrane-spanning 4A gene family. Members of this nascent protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues. The gene encoding this protein is localized to 11q12.1, among a cluster of family members. Alternative splicing of this gene results in several transcript variants. [provided by RefSeq]

Sequence: MTSQPVPNETIIVPPSNVINFSQAEKPEPTNQGQDSLKKHLHAEIKVIGTIQILCGMMVLSLGIILASASFSPNFTQVTSTLLNSAYPFIGPFFFIISGSLSIATEKRLTKLLVHSSLVGSILSALSALVGFIILSVKQATLNPASLQCELDKNNIPTRSYVSYFYHDSLYTTDCYTAKASLAGSLSLMLICTLLEFCLAVLTAVLRWKQAYSDFPGSVLFLPHSYIGNSGMSSKMTHDCGYEELLTS

Specifications

• Accession Number: AAH22854
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Weight (g/mol): 52.8kDa
• Purification Method: Glutathione Sepharose 4 Fast Flow
• Quantity: 10 ug
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Gene Alias: 4SPAN3/4SPAN3.2/CD20L3/CDA01/MGC131944/MGC22650/MS4A6/MST090/MSTP090
• Gene Symbol: MS4A6A
• Recombinant: Recombinant
• Expression System: wheat germ expression system

• For Use With (Application): Antibody Production, Protein Array, ELISA, Western Blot
• Gene ID (Entrez): 64231
• Name: MS4A6A (Human) Recombinant Protein (P01)
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Immunogen: MTSQPVPNETIIVPPSNVINFSQAEKPEPTNQGQDSLKKHLHAEIKVIGTIQILCGMMVLSLGIILASASFSPNFTQVTSTLLNSAYPFIGPFFFIISGSLSIATEKRLTKLLVHSSLVGSILSALSALVGFIILSVKQATLNPASLQCELDKNNIPTRSYVSYFYHDSLYTTDCYTAKASLAGSLSLMLICTLLEFCLAVLTAVLRWKQAYSDFPGSVLFLPHSYIGNSGMSSKMTHDCGYEELLTS
• Regulatory Status: RUO
• Common Name: MS4A6A
• Species: Wheat Germ (in vitro)
• Protein Tag: GST
• Form: Liquid