Abnova™ Human MSL3L1 Partial ORF (NP_523353.1, 1 a.a. - 79 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Supplier:  Abnova™ H00010943Q01L

Catalog No. 89-953-048

Description

This gene encodes a nuclear protein and has similarity to drosophila male-specific lethal-3 gene. The drosophila protein plays a critical role in a dosage-compensation pathway, which equalizes X-linked gene expression in males and females. Thus this encoded protein is thought to play a similar function in chromatin remodeling and transcriptional regulation. This gene has been found to undergo X inactivation. There are four alternatively spliced transcript variants of this gene encoding different isoforms. [provided by RefSeq]

Sequence: MSASEGMKFKFHSGEKVLCFEPDPTKARVLYDAKIVVVIVGKDEKGRKIPEYLIHFNGWNRSWDRWAAEDHVLRDTDEN

Specifications

• Accession Number: NP_523353.1
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Weight (g/mol): 34.43kDa
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Immunogen: MSASEGMKFKFHSGEKVLCFEPDPTKARVLYDAKIVVVIVGKDEKGRKIPEYLIHFNGWNRSWDRWAAEDHVLRDTDEN
• Regulatory Status: RUO
• Common Name: MSL3
• Species: Wheat Germ (in vitro)
• Protein Tag: GST
• Form: Liquid

• For Use With (Application): Antibody Production, ELISA, Protein Array, Western Blot
• Gene ID (Entrez): 10943
• Name: MSL3L1 (Human) Recombinant Protein (Q01)
• Quantity: 25 ug
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Gene Alias: DKFZp586J1822/MSL3L1
• Gene Symbol: MSL3
• Recombinant: Recombinant
• Expression System: wheat germ expression system