Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Abnova™ Human OR6W1P Full-length ORF (AAH69382.2, 1 a.a. - 280 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Manufacturer:  Abnova™ H00089883P01L

 View more versions of this product

Catalog No. 89-955-260


Add to cart

Description

Description

Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. [provided by RefSeq]

Sequence: MLLGNLAIISFICLDSRLHSPMYFFLCNFSLMEMVVTSTVVHRMLADLLSTHKTMSLAKCLTQSFFYFSLGSANFLILMVMAFDRYVAICHPLRYPTITNGPVCVKLVVACWVVGFLSIVSPTLQKTRLWFCGPNIIGHYFCDSAPLLKLACSDTRHIERMDLFLSLLFVLTTMLLIILSYILIVAAVLHIPSSSGCQKAFSTCASHLTVVVLGYGSAIFIYVRPGKGHSTYLNKAVAMVTAMVTPFLNPFIFTFRNEKVKEVIEDVTKRIFLGDPAACR
Specifications

Specifications

AAH69382.2
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
57.7kDa
Glutathione Sepharose 4 Fast Flow
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
OR6W1|sdolf
OR6W1P
Yes
wheat germ expression system
Liquid
89883
OR6W1P (Human) Recombinant Protein (P01)
12.5% SDS-PAGE Stained with Coomassie Blue.
MLLGNLAIISFICLDSRLHSPMYFFLCNFSLMEMVVTSTVVHRMLADLLSTHKTMSLAKCLTQSFFYFSLGSANFLILMVMAFDRYVAICHPLRYPTITNGPVCVKLVVACWVVGFLSIVSPTLQKTRLWFCGPNIIGHYFCDSAPLLKLACSDTRHIERMDLFLSLLFVLTTMLLIILSYILIVAAVLHIPSSSGCQKAFSTCASHLTVVVLGYGSAIFIYVRPGKGHSTYLNKAVAMVTAMVTPFLNPFIFTFRNEKVKEVIEDVTKRIFLGDPAACR
RUO
OR6W1P
Wheat Germ (in vitro)
GST
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit