Abnova™ Human PAGE4 Full-length ORF (NP_008934.1, 1 a.a. - 102 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Catalog Number	Mfr. No.	Quantity
89-955-589	Abnova™ H00009506P01S	10 ug
89-955-590	Abnova™ H00009506P01L	25 ug

Description

This gene is a member of the GAGE family. The GAGE genes are expressed in a variety of tumors and in some fetal and reproductive tissues. This gene is strongly expressed in prostate and prostate cancer, but is also expressed in other male and female reproductive tissues including testis, fallopian tube, uterus, and placenta, as well as in testicular cancer and uterine cancer. The protein encoded by this gene shares sequence similarity with other GAGE/PAGE proteins, and also belongs to a family of CT (cancer-testis) antigens. [provided by RefSeq]

Sequence: MSARVRSRSRGRGDGQEAPDVVAFVAPGESQQEEPPTDNQDIEPGQEREGTPPIEERKVEGDCQEMDLEKTRSERGDGSDVKEKTPPNPKHAKTKEAGDGQP

Specifications

• Accession Number: NP_008934.1
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Weight (g/mol): 37.6kDa
• Purification Method: Glutathione Sepharose 4 Fast Flow
• Immunogen: MSARVRSRSRGRGDGQEAPDVVAFVAPGESQQEEPPTDNQDIEPGQEREGTPPIEERKVEGDCQEMDLEKTRSERGDGSDVKEKTPPNPKHAKTKEAGDGQP
• Regulatory Status: RUO
• Common Name: PAGE4
• Species: Wheat Germ (in vitro)
• Protein Tag: GST
• Form: Liquid

• For Use With (Application): Antibody Production, Protein Array, ELISA, Western Blot
• Gene ID (Entrez): 9506
• Name: PAGE4 (Human) Recombinant Protein (P01)
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Gene Alias: FLJ35184/GAGE-9/GAGEC1/JM-27/JM27/PAGE-1/PAGE-4
• Gene Symbol: PAGE4
• Recombinant: Recombinant
• Expression System: wheat germ expression system