Abnova™ Human PCDH19 Partial ORF (NP_065817.1, 241 a.a. - 340 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Supplier:  Abnova™ H00057526Q01S

Catalog No. 89-955-860

Description

Protocadherins form a subfamily of calcium-dependent cell-cell adhesion molecules in the cadherin superfamily. Protocadherin-10 belongs to a subclass of protocadherins that share a highly conserved 17-amino acid cytoplasmic motif (Wolverton and Lalande, 2001 [PubMed 11549318]). PCDH19 belongs to the delta-2 protocadherin subclass of the cadherin superfamily (Dibbens et al., 2008) [PubMed 18469813].[supplied by OMIM]

Sequence: RLVPRDVEETDKMNVVSCSSLTSSLNYFDYHQQTLPLGCRRSESTFLNVENQNTRNTSANHIYHHSFNSQGPQQPDLIINGAPLPETENYSFDSNYVNSR

Specifications

• Accession Number: NP_065817.1
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Weight (g/mol): 36.63kDa
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue
• Immunogen: RLVPRDVEETDKMNVVSCSSLTSSLNYFDYHQQTLPLGCRRSESTFLNVENQNTRNTSANHIYHHSFNSQGPQQPDLIINGAPLPETENYSFDSNYVNSR
• Regulatory Status: RUO
• Common Name: PCDH19
• Species: Wheat Germ (in vitro)
• Protein Tag: GST
• Form: Liquid

• For Use With (Application): Antibody Production, ELISA, Protein Array, Western Blot
• Gene ID (Entrez): 57526
• Name: PCDH19 (Human) Recombinant Protein (Q01)
• Quantity: 10 ug
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Gene Alias: DKFZp686P1843/EFMR/KIAA1313
• Gene Symbol: PCDH19
• Recombinant: Recombinant
• Expression System: wheat germ expression system