Abnova™ Human PDGFA/PDGFB (heterodimer) Recombinant Protein

Used for Func, SDS-PAGE

Supplier:  Abnova™ P4800

Catalog No. 89-956-242

Description

The protein encoded by this gene is a member of the platelet-derived growth factor family. The four members of this family are mitogenic factors for cells of mesenchymal origin and are characterized by a motif of eight cysteines. This gene product can exist either as a homodimer (PDGF-BB) or as a heterodimer with the platelet-derived growth factor alpha polypeptide (PDGF-AB), where the dimers are connected by disulfide bonds. Mutations in this gene are associated with meningioma. Reciprocal translocations between chromosomes 22 and 7, at sites where this gene and that for COL1A1 are located, are associated with a particular type of skin tumor called dermatofibrosarcoma protuberans resulting from unregulated expression of growth factor. Two alternatively spliced transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq]

Sequence: PDGFA: MSIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATTSLNPDYREEDTGRPRESGKKRKRKRLKPT

Specifications

• Accession Number: P04085 (Gene ID : 5154);P01127 (Gene ID : 5155)
• Formulation: Lyophilized
• Molecular Weight (g/mol): 13.3kDa
• Preparation Method: Escherichia coli expression system
• Immunogen: Alpha chain: MSIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATTSLNPDYREEDTGRPRESGKKRKRKRLKPT Beta chain: MSLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVT
• Regulatory Status: RUO
• Gene Alias: PDGF-A/PDGF1
• Gene Symbol: PDGFA
• Species: E. coli
• Protein Tag: None
• Form: Lyophilized

• For Use With (Application): Functional Study, SDS-PAGE
• Gene ID (Entrez): 5154/5155
• Name: PDGFA/PDGFB (Human) Recombinant Protein
• Quantity: 10 ug
• Storage Requirements: Store at -20°C on dry atmosphere. After reconstitution with sterilized water, store at -20°C. Aliquot to avoid repeated freezing and thawing.
• Endotoxin Concentration: <0.1 EU/μg
• Common Name: PDGFA
• Biological Activity: The activity is determined by the dose-dependent proliferation of mouse 3T3 indicator cells. The expected ED50 for this effect is 1.4-2.1ng/mL.
• Recombinant: Recombinant
• Expression System: Escherichia coli expression system