Invitrogen™ Human PREP (aa 249-336) Control Fragment Recombinant Protein

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56725 (PA5-56725. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

p33cdk2 associates with cyclin A in human cells. Kinase activity associated with cyclin A-cdc2 is found only in G2-phase. Cdk2 also complexes with cyclins E, D1, and D3. Cyclin E-cdk2 kinase is active in the G1- and S-phases of the cell cycle and is important (as does cyclin A-cdk2) for the progression from G1-to S-phase. The levels of cyclin A-cdk2 is maximal at the G1/S transition and both cdk2 and cyclin A are found associated with DNA in the initiation complex during replication. Rb protein acts as substrate for cdk2-cyclin E and/or cdk2-cyclin A in vivo. Cdk2 is activated and specifically localized to the nucleus during late G1-, S-, and G2-phase.

Specifications

• Accession Number: P48147
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 5550
• Name: Human PREP (aa 249-336) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI047692; AI450383; D10Wsu136e; dJ355L5.1 (prolyl endopeptidase); EC 3.4.21.26; MGC16060; PE; PE {ECO:0000250; PEP; Pop; post-proline cleaving enzyme; post-proline cleaving enzyme {ECO:0000250; Prep; prep {ECO:0000312; Prolyl endopeptidase; prolyl endopeptidase {ECO:0000250; prolyl oligopeptidase; RGD:620841}; rPop; UniProtKB:P23687}
• Common Name: PREP
• Gene Symbol: PREP
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LSIREGCDPVNRLWYCDLQQESSGIAGILKWVKLIDNFEGEYDYVTNEGTVFTFKTNRQSPNYRVINIDFRDPEESKWKVLVPEHEKD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining