Abnova™ Human PSMF1 (NP_006805, 1 a.a. - 271 a.a.) Full-length Recombinant Protein with His-tag

Used for Func, SDS-PAGE

Manufacturer:  Abnova™ P4540

Catalog No. 89-958-607

Description

The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a protein that inhibits the activation of the proteasome by the 11S and 19S regulators. Alternative transcript variants have been identified for this gene. [provided by RefSeq]

Sequence: MGSSHHHHHHSSGLVPRGSHMAGLEVLFASAAPAITCRQDALVCFLHWEVVTHGYCGLGVGDQPGPNDKKSELLPAGWNNNKDLYVLRYEYKDGSRKLLVKAITVESSMILNVLEYGSQQVADLTLNLDDYIDAEHLGDFHRTYKNSEELRSRIVSGIITPIHEQWEKANVSSPHREFPPATAREVDPLRIPPHHPHTSRQPPWCDPLGPFVVGGEDLDPFGPRRGGMIVDPLRSGFPRALIDPSSGLPNRLPPGAVPPGARFDPFGPIGTSPPGPNPDHLPPPGYDDMYL

Specifications

• Accession Number: NP_006805
• Concentration: 0.5 mg/mL
• Format: Liquid
• Gene ID (Entrez): 9491
• Name: PSMF1 (Human) Recombinant Protein
• Purity: >85% by SDS - PAGE
• Quantity: 100 ug
• Regulatory Status: RUO
• Common Name: PSMF1
• Host Species: Escherichia coli
• Protein Tag: His

• Expression System: Escherichia coli expression system
• For Use With (Application): Functional Study, Sodium Dodecyl Sulfate–Polyacrylamide Gel Electrophoresis
• Formulation: Liquid
• Molecular Weight: 31.9kDa
• Preparation Method: Escherichia coli expression system
• Quality Control Testing: 15% SDS-PAGE Stained with Coomassie Blue
• Storage Requirements: Store at -20°C. For long term storage store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Gene Alias: PI31
• Gene Symbol: PSMF1
• Recombinant: Yes