Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Abnova™ Human PTBP2 Partial ORF (AAH16582.1, 35 a.a. - 175 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Supplier: Abnova™ H00058155Q01L
Description
The protein encoded by this gene binds to the intronic cluster of RNA regulatory elements, downstream control sequence (DCS). It is implicated in controlling the assembly of other splicing-regulatory proteins. This protein is very similar to the polypyrimidine tract binding protein but it is expressed primarily in the brain. [provided by RefSeq]
Sequence: MVVTANGNDSKKFKGEDKMDGAPSRVLHIRKLPGEVTETEVIALGLPFGKVTNILMLKGKNQAFLELATEEAAITMVNYYSAVTPHLRNQPIYIQYSNHKELKTDNTLNQRAQAVLQAVTAVQTANTPLSGTTVSESAVTPSpecifications
| AAH16582.1 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 41.25kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| MVVTANGNDSKKFKGEDKMDGAPSRVLHIRKLPGEVTETEVIALGLPFGKVTNILMLKGKNQAFLELATEEAAITMVNYYSAVTPHLRNQPIYIQYSNHKELKTDNTLNQRAQAVLQAVTAVQTANTPLSGTTVSESAVTP | |
| RUO | |
| PTBP2 | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 58155 | |
| PTBP2 (Human) Recombinant Protein (Q01) | |
| 25 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| FLJ34897/PTB/PTBLP/brPTB/nPTB/nPTB5/nPTB6/nPTB7/nPTB8 | |
| PTBP2 | |
| Recombinant | |
| wheat germ expression system |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction