Abnova™ Human PTGIS Partial ORF (NP_000952, 391 a.a. - 500 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Catalog Number	Mfr. No.	Quantity
89-958-703	Abnova™ H00005740Q01L	25 ug
89-958-702	Abnova™ H00005740Q01S	10 ug

Description

This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. However, this protein is considered a member of the cytochrome P450 superfamily on the basis of sequence similarity rather than functional similarity. This endoplasmic reticulum membrane protein catalyzes the conversion of prostglandin H2 to prostacyclin (prostaglandin I2), a potent vasodilator and inhibitor of platelet aggregation. An imbalance of prostacyclin and its physiological antagonist thromboxane A2 contribute to the development of myocardial infarction, stroke, and atherosclerosis. [provided by RefSeq]

Sequence: PQRDPEIYTDPEVFKYNRFLNPDGSEKKDFYKDGKRLKNYNMPWGAGHNHCLGRSYAVNSIKQFVFLVLVHLDLELINADVEIPEFDLSRYGFGLMQPEHDVPVRYRIRP

Specifications

• Accession Number: NP_000952
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Weight (g/mol): 37.84kDa
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Gene Alias: CYP8/CYP8A1/MGC126858/MGC126860/PGIS/PTGI
• Gene Symbol: PTGIS
• Recombinant: Recombinant
• Expression System: wheat germ expression system

• For Use With (Application): Antibody Production, ELISA, Protein Array, Western Blot
• Gene ID (Entrez): 5740
• Name: PTGIS (Human) Recombinant Protein (Q01)
• Immunogen: PQRDPEIYTDPEVFKYNRFLNPDGSEKKDFYKDGKRLKNYNMPWGAGHNHCLGRSYAVNSIKQFVFLVLVHLDLELINADVEIPEFDLSRYGFGLMQPEHDVPVRYRIRP
• Regulatory Status: RUO
• Common Name: PTGIS
• Species: Wheat Germ (in vitro)
• Protein Tag: GST
• Form: Liquid