Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Abnova™ Human Rax Partial Orf (Np_038463.2, 104 A.A.-206 A.A.) Recombinant Protein With Gst Tag At N-Terminal.
Recombinant proteins expressed from in vitro wheat germ system. Such proteins mirror the conformation and folding of the native proteins in the eukaryotic biological system.
Supplier: Abnova™ H00030062Q01S
Description
- Good Folding
- Excellent amino acids labeling
Immunogen Sequence: KEPWEARPSPGLPVGPATGEAKLSEEEQPKKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAGKVNLPEVRVQVWFQNRRAKWRRQEKLEVSSMKLQD
Specifications
NP_038463.2 | |
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | |
RAX (Human) Recombinant Protein (Q01) | |
12.5% SDS-PAGE Stained with Coomassie Blue | |
KEPWEARPSPGLPVGPATGEAKLSEEEQPKKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAGKVNLPEVRVQVWFQNRRAKWRRQEKLEVSSMKLQD | |
RUO | |
RAX | |
GST |
Antibody Production, ELISA, Protein Array, Western Blot | |
30062 | |
Glutathione Sepharose 4 Fast Flow | |
10 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
MCOP3/RX | |
RAX | |
Liquid |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?
Provide Content Correction