Invitrogen™ Human RTN4IP1 (aa 299-390) Control Fragment Recombinant Protein

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57625 (PA5-57625. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a novel mitochondrial protein that interacts with reticulon 4, which is a potent inhibitor of regeneration following spinal cord injury. The interaction of reticulon 4 with mitochondrial proteins may provide insight into the mechanisms for reticulon-induced inhibition of neurite growth.

Specifications

• Accession Number: Q8WWV3
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 84816
• Name: Human RTN4IP1 (aa 299-390) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: D10Ertd690e; Nimp; NOGO-interacting mitochondrial protein; OPA10; reticulon 4 interacting protein 1; reticulon 4 interacting protein 1, mitochondrial; reticulon-4-interacting protein 1, mitochondrial; RGD1563384; RTN4IP1
• Common Name: RTN4IP1
• Gene Symbol: Rtn4ip1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TLVTPFLLNMDRLGIADGMLQTGVTVGSKALKHFWKGVHYRWAFFMASGPCLDDIAELVDAGKIRPVIEQTFPFSKVPEAFLKVERGHARGK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining