Abnova™ Human SEMA4G Full-length ORF (AAH20960.1, 1 a.a. - 127 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Supplier:  Abnova™ H00057715P02S

Catalog No. 89-961-407

Description

Semaphorins are a large family of conserved secreted and membrane associated proteins which possess a semaphorin (Sema) domain and a PSI domain (found in plexins, semaphorins and integrins) in the N-terminal extracellular portion. Based on sequence and structural similarities, semaphorins are put into eight classes: invertebrates contain classes 1 and 2, viruses have class V, and vertebrates contain classes 3-7. Semaphorins serve as axon guidance ligands via multimeric receptor complexes, some (if not all) containing plexin proteins. This gene encodes a class 4 semaphorin. This gene and the gene for mitochondrial ribosomal protein L43 overlap at map location 10q24.31 and are transcribed in opposite directions. [provided by RefSeq]

Sequence: MGSMSPPSAWPCVLDGPETRQDLCQPPKPCVHSHAHMEECLSAGLQCPHPHLLLVHSCFIPASGLGVPSQLPHPIWSSSPAPCGDLFVKSLGTGQPGEVRLHHSPPLPSCVALVNQPPHSPWSFSRV

Specifications

• Accession Number: AAH20960.1
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Weight (g/mol): 39.9kDa
• Purification Method: Glutathione Sepharose 4 Fast Flow
• Quantity: 10 ug
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Gene Alias: FLJ20590/KIAA1619/MGC102867
• Gene Symbol: SEMA4G
• Recombinant: Recombinant
• Expression System: wheat germ expression system

• For Use With (Application): Antibody Production, Protein Array, ELISA, Western Blot
• Gene ID (Entrez): 57715
• Name: SEMA4G (Human) Recombinant Protein (P02)
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Immunogen: MGSMSPPSAWPCVLDGPETRQDLCQPPKPCVHSHAHMEECLSAGLQCPHPHLLLVHSCFIPASGLGVPSQLPHPIWSSSPAPCGDLFVKSLGTGQPGEVRLHHSPPLPSCVALVNQPPHSPWSFSRV
• Regulatory Status: RUO
• Common Name: SEMA4G
• Species: Wheat Germ (in vitro)
• Protein Tag: GST
• Form: Liquid