Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Abnova™ Human SULF2 Full-length ORF (AAH20962, 1 a.a. - 149 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Specifications

Name Human SULF2 Full-length ORF (AAH20962, 1 a.a. - 149 a.a.) Recombinant Protein with GST-tag at N-terminal
Recombinant Yes
Purification Method Glutathione Sepharose 4 Fast Flow
For Use With (Application) AP, Array, ELISA, WB-Re
Molecular Weight 42.13kDa
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
89-963-754
View Documents
Abnova™
H00055959P01L
25μg This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. N/A
89-963-753
View Documents
Abnova™
H00055959P01S
10μg This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. N/A
Description

Description

Heparan sulfate proteoglycans (HSPGs) act as coreceptors for numerous heparin-binding growth factors and cytokines and are involved in cell signaling. Heparan sulfate 6-O-endosulfatases, such as SULF2, selectively remove 6-O-sulfate groups from heparan sulfate. This activity modulates the effects of heparan sulfate by altering binding sites for signaling molecules (Dai et al., 2005 [PubMed 16192265]).[supplied by OMIM]

Sequence: MPGLTCFTHDNQHWQTAPFWTLGPFCACTSANNNTYWCMRTINETHNFLFCEFATGFLEYFDLNTDPYQLMNAVNTLDRDVLNQLHVQLMELRSCKGYKQCNPRTRNMDLGLKDGGSYEQYRQFQRRKWPEMKRPSSKSLGQLWEGWEG
Specifications

Specifications

Human SULF2 Full-length ORF (AAH20962, 1 a.a. - 149 a.a.) Recombinant Protein with GST-tag at N-terminal
Glutathione Sepharose 4 Fast Flow
42.13kDa
Yes
AP, Array, ELISA, WB-Re
Store at −80°C. Aliquot to avoid repeated freezing and thawing.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit