Abnova™ Human TMC8 Partial ORF (NP_689681.2, 616 a.a. - 674 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Catalog Number	Mfr. No.	Quantity
89-943-697	Abnova™ H00147138Q01S	10 ug
89-943-698	Abnova™ H00147138Q01L	25 ug

Description

Epidermodysplasia verruciformis (EV) is an autosomal recessive dermatosis characterized by abnormal susceptibility to human papillomaviruses (HPVs) and a high rate of progression to squamous cell carcinoma on sun-exposed skin. EV is caused by mutations in either of two adjacent genes located on chromosome 17q25.3. Both of these genes encode integral membrane proteins that localize to the endoplasmic reticulum and are predicted to form transmembrane channels. This gene encodes a transmembrane channel-like protein with 8 predicted transmembrane domains and 3 leucine zipper motifs. [provided by RefSeq]

Sequence: SQTQANARAIHRLRKQLVWQVQEKWHLVEDLSRLLPEPGPSDSPGPKYPASQASRPQSF

Specifications

• Accession Number: NP_689681.2
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Weight (g/mol): 32.23kDa
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Gene Alias: EV2/EVER2/EVIN2/FLJ40668/FLJ43684/MGC102701/MGC40121
• Gene Symbol: TMC8
• Recombinant: Recombinant
• Expression System: wheat germ expression system

• For Use With (Application): Antibody Production, ELISA, Protein Array, Western Blot
• Gene ID (Entrez): 147138
• Name: TMC8 (Human) Recombinant Protein (Q01)
• Immunogen: SQTQANARAIHRLRKQLVWQVQEKWHLVEDLSRLLPEPGPSDSPGPKYPASQASRPQSF
• Regulatory Status: RUO
• Common Name: TMC8
• Species: Wheat Germ (in vitro)
• Protein Tag: GST
• Form: Liquid