Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Abnova™ Human TUBB Partial ORF (AAH19924.1, 239 a.a. - 319 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Manufacturer:  Abnova™ H00203068Q01L

 View more versions of this product

Catalog No. 89-966-173


Add to cart

Description

Description

Sequence: CLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQVFDAKNMMAACDPRHGRYLTVAAVFRG
Specifications

Specifications

AAH19924.1
Liquid
203068
Human TUBB Partial ORF (AAH19924.1, 239 a.a. - 319 a.a.) Recombinant Protein with GST-tag at N-terminal
25μg
RUO
TUBB
wheat germ expression system
Yes
AP, Array, ELISA, WB-Re
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
34.54kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
Store at −80°C. Aliquot to avoid repeated freezing and thawing.
M40, MGC117247, MGC16435, OK/SW-cl.56, TUBB1, TUBB5
TUBB
Wheat Germ (in vitro)
GST Tag
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit