Abnova™ Human UCP1 Partial ORF (NP_068605, 232 a.a. - 267 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Catalog Number	Mfr. No.	Quantity
89-966-514	Abnova™ H00007350Q01L	25 ug
89-966-513	Abnova™ H00007350Q01S	10 ug

Description

Mitochondrial uncoupling proteins (UCP) are members of the family of mitochondrial anion carrier proteins (MACP). UCPs separate oxidative phosphorylation from ATP synthesis with energy dissipated as heat, also referred to as the mitochondrial proton leak. UCPs facilitate the transfer of anions from the inner to the outer mitochondrial membrane and the return transfer of protons from the outer to the inner mitochondrial membrane. They also reduce the mitochondrial membrane potential in mammalian cells. Tissue specificity occurs for the different UCPs and the exact methods of how UCPs transfer H+/OH- are not known. UCPs contain the three homologous protein domains of MACPs. This gene is expressed only in brown adipose tissue, a specialized tissue which functions to produce heat. [provided by RefSeq]

Sequence: PVDVVKTRFINSPPGQYKSVPNCAMKVFTNEGPTAF

Specifications

• Accession Number: NP_068605
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Weight (g/mol): 29.7kDa
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Gene Alias: SLC25A7/UCP
• Gene Symbol: UCP1
• Recombinant: Recombinant
• Expression System: wheat germ expression system

• For Use With (Application): Antibody Production, ELISA, Protein Array, Western Blot
• Gene ID (Entrez): 7350
• Name: UCP1 (Human) Recombinant Protein (Q01)
• Immunogen: PVDVVKTRFINSPPGQYKSVPNCAMKVFTNEGPTAF
• Regulatory Status: RUO
• Common Name: UCP1
• Species: Wheat Germ (in vitro)
• Protein Tag: GST
• Form: Liquid