Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Abnova™ Human Vsig8 Full-Length Orf (Adr83364.1) Recombinant Protein Without Tag.

Name: Abnova&trade; Human Vsig8 Full-Length Orf (Adr83364.1) Recombinant Protein Without Tag.
Brand: Abnova&trade;
SKU: 89-032-117
Price: 876.00 USD

Recombinant proteins expressed from in vitro wheat germ system. Such proteins mirror the conformation and folding of the native proteins in the eukaryotic biological system.

Supplier: Abnova™ H00391123G01

Catalog No. 89-032-117

$876.00 / Each of 1

Qty

Add to Cart

Description

Good Folding

Immunogen Sequence: MRVGGAFHLLLVCLSPALLSAVRINGDGQEVLYLAEGDNVRLGCPYVLDPEDYGPNGLDIEWMQVNSDPAHHRENVFLSYQDKRINHGSLPHLQQRVRFAASDPSQYDASINLMNLQVSDTATYECRVKKTTMATRKVIVTVQARPAVPMCWTEGHMTYGNDVVLKCYASGGSQPLSYKWAKISGHHYPYRAGSYTSQHSYHS

Specifications

Accession Number	ADR83364.1
Formulation	Liquid
Name	VSIG8 (Human) Recombinant Protein
Immunogen	MRVGGAFHLLLVCLSPALLSAVRINGDGQEVLYLAEGDNVRLGCPYVLDPEDYGPNGLDIEWMQVNSDPAHHRENVFLSYQDKRINHGSLPHLQQRVRFAASDPSQYDASINLMNLQVSDTATYECRVKKTTMATRKVIVTVQARPAVPMCWTEGHMTYGNDVVLKCYASGGSQPLSYKWAKISGHHYPYRAGSYTSQHSYHSELSYQESFHSSINQGLNNGDLVLKDISRADDGLYQCTVANNVGYSVCVVEVKVSDSRRIGVIIGIVLGSLLALGCLAVGIWGLVCCCCGGSGAGGARGAFGYGNGGGVGGGACGDLASEIREDAVAPGCKASGRGSRVTHLLGYPTQNVSRSLRRKYAPPPCGGPEDVALAPCTAAAACEAGPSPVYVKVKSAEPADCAEGPVQCKNGLLV
Regulatory Status	RUO
Gene Symbol	VSIG8
Protein Tag	None

For Use With (Application)	Antibody Production, Compound Screening, Functional Study
Gene ID (Entrez)	391123
Quantity	10 ug
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Common Name	VSIG8
Species	Wheat Germ (in vitro)
Form	Liquid

Product Suggestions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

Full Name:

Email Address:*

User Name:

Telephone Number:

What type of issue did you experience with the content on the page?*

Please provide a detailed description of the issue or request*

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only

Spot an opportunity for improvement?

Provide Content Correction

Abnova™ Human Vsig8 Full-Length Orf (Adr83364.1) Recombinant Protein Without Tag.

Description

Specifications

Product Suggestions

Documents

Promotions