Huntingtin Interacting Protein K Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP310150100UL

Catalog No. NB125201

Description

Huntingtin Interacting Protein K Polyclonal specifically detects Huntingtin Interacting Protein K in Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: Huntingtin Interacting Protein K
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: C15orf63, chromosome 15 open reading frame 63, EC 2.1.1.43, EC 2.7.7.6, FLJ20431, HSPC136, Huntingtin yeast partner K, huntingtin-interacting protein K, HYPKHuntingtin interacting protein K
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of mouse Huntingtin Interacting Protein K (NP_080594.2). Peptide sequence DVELELETETSGPERPPEKPRKHDSGAADLERVTDYAEEKEIQSSNLETA
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Mouse
• Form: Purified

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS buffer, 2% sucrose
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 25764
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.