Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Huntingtin Interacting Protein K Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP310150100UL
Description
Huntingtin Interacting Protein K Polyclonal specifically detects Huntingtin Interacting Protein K in Mouse samples. It is validated for Western Blot.Specifications
Huntingtin Interacting Protein K | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
C15orf63, chromosome 15 open reading frame 63, EC 2.1.1.43, EC 2.7.7.6, FLJ20431, HSPC136, Huntingtin yeast partner K, huntingtin-interacting protein K, HYPKHuntingtin interacting protein K | |
The immunogen is a synthetic peptide directed towards the middle region of mouse Huntingtin Interacting Protein K (NP_080594.2). Peptide sequence DVELELETETSGPERPPEKPRKHDSGAADLERVTDYAEEKEIQSSNLETA | |
100 μg | |
Primary | |
Mouse | |
Purified |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
25764 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction