Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Hydrogen Potassium ATPase Beta Rabbit anti-Rat, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus BiologicalsSupplier Diversity Partner NBP19157320UL

 View more versions of this product

Catalog No. NBP19157320

Add to cart



Hydrogen Potassium ATPase Beta Polyclonal antibody specifically detects Antigen in Rat samples. It is validated for Western Blotting.


Hydrogen Potassium ATPase Beta
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
Synthetic peptide directed towards the C terminal of human Atp4b. Peptide sequence QPHYSNPLVAAKFLNVPKNTQVLIVCKIMADHVTFDNPHDPYEGKVEFKL.
Immunogen affinity purified
Western Blot
Western Blot 0.2-1 ug/ml
ATP6B, ATPase, H+/K+ exchanging, beta polypeptide, ATPase, H+/K+ transporting, beta polypeptide, Gastric H(+)/K(+) ATPase subunit beta, gastric H+/K+ ATPase beta subunit, gastric hydrogen-potassium ATPase, beta, potassium-transporting ATPase beta chain, potassium-transporting ATPase subunit beta, Proton pump beta chain
Store at -20C. Avoid freeze-thaw cycles.
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit