Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
HYLS1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Specifications
| Antigen | HYLS1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15689920
|
Novus Biologicals
NBP15689920UL |
20 μL |
Each for $152.22
|
N/A |
NBP156899
|
Novus Biologicals
NBP156899 |
100 μL |
Each for $436.00
|
N/A |
Description
HYLS1 Polyclonal specifically detects HYLS1 in Human samples. It is validated for Western Blot.Specifications
| HYLS1 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| FLJ32915HLS, hydrolethalus syndrome 1, hydrolethalus syndrome protein 1 | |
| HYLS1 | |
| IgG | |
| Affinity Purified |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q96M11 | |
| 219844 | |
| Synthetic peptides corresponding to HYLS1(hydrolethalus syndrome 1) The peptide sequence was selected from the middle region of HYLS1. Peptide sequence YFEYKRDWDSIRLPGEDHRKELRWGVREQMLCRAEPQSKPQHIYVPNNYL. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title