IBRDC1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159776

Catalog No. NBP159776

Description

IBRDC1 Polyclonal specifically detects IBRDC1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: IBRDC1
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q8TC41
• Gene Symbols: RNF217
• Immunogen: Synthetic peptides corresponding to RNF217(ring finger protein 217) The peptide sequence was selected from the middle region of RNF217. Peptide sequence GLALGAIAVVIVEEIKTYWNLISGRTRNQTQHLAPQPVLLSDMLYCLKQV.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%;.
• Target Species: Human, Yeast
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS & 2% Sucrose. with 0.09% Sodium Azide
• Gene Alias: C6orf172, chromosome 6 open reading frame 172, dJ84N20.1, EC 6.3.2.-, IBR domain containing 1, IBRDC1, MGC26996, probable E3 ubiquitin-protein ligase RNF217, ring finger protein 217IBR domain-containing protein 1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 154214
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.