Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
IBSP/Sialoprotein II Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
| Antigen | IBSP/Sialoprotein II |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NB120117
|
Novus Biologicals
NBP310985100UL |
100 μg |
Each of 1 for $482.50
|
|
|||||
Description
IBSP/Sialoprotein II Polyclonal specifically detects IBSP/Sialoprotein II in Mouse samples. It is validated for Western Blot.Specifications
| IBSP/Sialoprotein II | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Mouse | |
| BNSP, Bone sialoprotein, Bone sialoprotein 2, BSP, BSP 2, BSP II, BSP2, BSPII, Cell binding sialoprotein, IBSP, Integrin binding sialoprotein, SP II, SPII | |
| The immunogen is a synthetic peptide directed towards the N terminal region of mouse IBSP/Sialoprotein II (NP_032344.2). Peptide sequence MACAFSMKNFHRRIKAEDSEENGVFKYRPRYFLYKHAYFYPPLKRFPVQG | |
| Affinity purified |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS buffer, 2% sucrose | |
| 3381 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title