Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
IF3EI Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15692620UL
Description
IF3EI Polyclonal specifically detects IF3EI in Human samples. It is validated for Western Blot.Specifications
IF3EI | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
Q9Y262 | |
EIF3L | |
Synthetic peptides corresponding to EIF3EIP(eukaryotic translation initiation factor 3, subunit E interacting protein) The peptide sequence was selected from the N terminal of EIF3EIP. Peptide sequence SYPADDYESEAAYDPYAYPSDYDMHTGDPKQDLAYER | |
20 μL | |
Core ESC Like Genes, Stem Cell Markers | |
51386 | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
eIEF associated protein HSPC021, EIF3EIP, eIF3l, EIF3S11, EIF3S6IP, Eukaryotic translation initiation factor 3 subunit 6-interacting protein, Eukaryotic translation initiation factor 3 subunit E-interacting protein, eukaryotic translation initiation factor 3 subunit L, eukaryotic translation initiation factor 3, subunit 6 interacting protein, eukaryotic translation initiation factor 3, subunit L, HSPC021, HSPC025, MSTP005, subunit E interacting protein | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
This product is specific to Subunit or Isoform: L. | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title