Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
IFI44 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$157.00 - $482.50
Specifications
| Antigen | IFI44 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15538020
|
Novus Biologicals
NBP15538020UL |
20 μL |
Each for $157.00
|
|
|||||
|
NBP155380
|
Novus Biologicals
NBP155380 |
100 μL |
Each for $482.50
|
|
|||||
Description
IFI44 Polyclonal specifically detects IFI44 in Human samples. It is validated for Western Blot.Specifications
| IFI44 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| interferon-induced protein 44, interferon-induced, hepatitis C-associated microtubular aggregate protein(44kD), MTAP44p44Microtubule-associated protein 44, P44 | |
| IFI44 | |
| IgG | |
| 50 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q8TCB0 | |
| 10561 | |
| Synthetic peptides corresponding to IFI44(interferon-induced protein 44) The peptide sequence was selected from the middle region of IFI44. Peptide sequence LIEIERCEPVRSKLEEVQRKLGFALSDISVVSNYSSEWELDPVKDVLILS. | |
| Primary |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title