Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
IFLTD1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | IFLTD1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP156726
|
Novus Biologicals
NBP156726 |
100 μL |
Each for $436.00
|
|
NBP15672620
|
Novus Biologicals
NBP15672620UL |
20 μL | This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. | N/A |
Description
IFLTD1 Polyclonal specifically detects IFLTD1 in Human samples. It is validated for Western Blot.Specifications
IFLTD1 | |
Polyclonal | |
Rabbit | |
Human | |
Q8N9Z9 | |
160492 | |
Synthetic peptides corresponding to IFLTD1(intermediate filament tail domain containing 1) The peptide sequence was selected from the middle region of IFLTD1. Peptide sequence PPTVFPNRSPWCQNPYVSAHPYCPLIEPHNTSTAGGRLDRQPRSRSTRPN. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
RUO | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
FLJ36004, intermediate filament tail domain containing 1, intermediate filament tail domain-containing protein 1, Pas1c1 | |
IFLTD1 | |
IgG | |
Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title