IFN-alpha G/IFNA5 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP157915

Catalog No. NBP157915

Description

IFN-alpha G/IFNA5 Polyclonal specifically detects IFN-alpha G/IFNA5 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: IFN-alpha G/IFNA5
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P01569
• Gene Symbols: IFNA5
• Immunogen: Synthetic peptides corresponding to IFNA5(interferon, alpha 5) The peptide sequence was selected from the middle region of IFNA5. Peptide sequence TELYQQLNDLEACMMQEVGVEDTPLMNVDSILTVRKYFQRITLYLTEKKY.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Mouse: 76%.
• Target Species: Human, Mouse, Rat, Equine, Guinea Pig
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: IFN-alpha-5, IFN-alphaG, INFA5, interferon alpha-5, Interferon alpha-61, Interferon alpha-G, interferon, alpha 5, LeIF G
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 3442
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.