Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
IFN-alpha G/IFNA5 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | IFN-alpha G/IFNA5 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP157915
|
Novus Biologicals
NBP157915 |
100 μL |
Each for $436.00
|
|
NBP15791520
|
Novus Biologicals
NBP15791520UL |
20 μL | This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. | N/A |
Description
IFN-alpha G/IFNA5 Polyclonal specifically detects IFN-alpha G/IFNA5 in Human samples. It is validated for Western Blot.Specifications
| IFN-alpha G/IFNA5 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| IFN-alpha-5, IFN-alphaG, INFA5, interferon alpha-5, Interferon alpha-61, Interferon alpha-G, interferon, alpha 5, LeIF G | |
| IFNA5 | |
| IgG | |
| Affinity Purified |
| Western Blot | |
| Unconjugated | |
| RUO | |
| P01569 | |
| 3442 | |
| Synthetic peptides corresponding to IFNA5(interferon, alpha 5) The peptide sequence was selected from the middle region of IFNA5. Peptide sequence TELYQQLNDLEACMMQEVGVEDTPLMNVDSILTVRKYFQRITLYLTEKKY. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title