Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

IFT140 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$152.22 - $436.00

Specifications

Antigen IFT140
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP18020720
View Documents
Novus Biologicals
NBP18020720UL
20 μL
Each for $152.22
Add to cart
 
NBP180207
View Documents
Novus Biologicals
NBP180207
100 μL
Each for $436.00
Add to cart
 
Description

Description

IFT140 Polyclonal specifically detects IFT140 in Human samples. It is validated for Western Blot.
Specifications

Specifications

IFT140
Polyclonal
Rabbit
NP_055529
9742
Synthetic peptide directed towards the N terminal of human IFT140. Peptide sequence VLRWSPSGNCLLSGDRLGVLLLWRLDQRGRVQGTPLLKHEYGKHLTHCIF.
Primary
Store at -20C. Avoid freeze-thaw cycles.
Western Blot
Unconjugated
RUO
FLJ30571, gs114, intraflagellar transport 140 homolog (Chlamydomonas), intraflagellar transport protein 140 homolog, WDTC2
IFT140
IgG
Affinity Purified
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit