Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
IFT140 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
Antigen | IFT140 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP18020720
|
Novus Biologicals
NBP18020720UL |
20 μL |
Each for $152.22
|
|
NBP180207
|
Novus Biologicals
NBP180207 |
100 μL |
Each for $436.00
|
|
Description
IFT140 Polyclonal specifically detects IFT140 in Human samples. It is validated for Western Blot.Specifications
IFT140 | |
Polyclonal | |
Rabbit | |
NP_055529 | |
9742 | |
Synthetic peptide directed towards the N terminal of human IFT140. Peptide sequence VLRWSPSGNCLLSGDRLGVLLLWRLDQRGRVQGTPLLKHEYGKHLTHCIF. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
RUO | |
FLJ30571, gs114, intraflagellar transport 140 homolog (Chlamydomonas), intraflagellar transport protein 140 homolog, WDTC2 | |
IFT140 | |
IgG | |
Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title