Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Ift80 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | Ift80 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP174179
|
Novus Biologicals
NBP174179 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
Ift80 Polyclonal specifically detects Ift80 in Mouse samples. It is validated for Western Blot.Specifications
| Ift80 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| ATD2, intraflagellar transport 80 homolog (Chlamydomonas), intraflagellar transport protein 80 homolog, KIAA1374WDR56WD repeat domain 56, MGC126543, WD repeat-containing protein 56 | |
| IFT80 | |
| IgG | |
| Affinity Purified | |
| 85 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q8K057 | |
| 57560 | |
| Synthetic peptides corresponding to the C terminal of Ift80. Immunizing peptide sequence PNTIYVDRDILPKTLYERDASEYSKNPHIVSFVGNQVTIRRADGSLVHIS. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title