Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

IGF2BP3 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$149.00 - $329.00

Specifications

Antigen IGF2BP3
Immunogen Synthetic peptides corresponding to Igf2bp3 (insulin-like growth factor 2 mRNA binding protein 3) The peptide sequence was selected from the middle region of Igf2bp3 (NP_076159). Peptide sequence QQNPSPQLRGRRGPGQRGSSRQASPGSVSKQKPCDLPLRLLVPTQFVGAI.
Host Species Rabbit
Primary or Secondary Primary
Monoclonal or Polyclonal Polyclonal
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP1689820 View Documents Novus BiologicalsSupplier Diversity Partner
NBP16898120UL
20ul Each for $149.00
Add to cart
 
NBP168981 View Documents Novus BiologicalsSupplier Diversity Partner
NBP168981
100 ul Each for $329.00
Add to cart
 
Description

Description

IGF2BP3 Polyclonal antibody specifically detects Antigen in Mouse samples. It is validated for Western Blotting.
Specifications

Specifications

IGF2BP3
Rabbit
Polyclonal
Unconjugated
10643
Affinity Purified
Western Blot
RUO
Synthetic peptides corresponding to Igf2bp3 (insulin-like growth factor 2 mRNA binding protein 3) The peptide sequence was selected from the middle region of Igf2bp3 (NP_076159). Peptide sequence QQNPSPQLRGRRGPGQRGSSRQASPGSVSKQKPCDLPLRLLVPTQFVGAI.
Primary
IgG
CT98, hKOC, IGF II mRNA binding protein 3, IGF2 mRNA-binding protein 3, IGF-II mRNA-binding protein 3, IMP-3KH domain-containing protein overexpressed in cancer, IMP3VICKZ family member 3, insulin-like growth factor 2 mRNA binding protein 3, insulin-like growth factor 2 mRNA-binding protein 3, KH domain containing protein overexpressed in cancer, KOC1DKFZp686F1078, VICKZ3cancer/testis antigen 98
PBS & 2% Sucrose. with No Preservative
Immunogen affinity purified
Store at -20C. Avoid freeze-thaw cycles.
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit