Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
IGHMBP2 Rabbit anti-Human, Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP16892120UL
Description
IGHMBP2 Polyclonal specifically detects IGHMBP2 in Human, Mouse samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
| IGHMBP2 | |
| Polyclonal | |
| Western Blot 1:100-1:2000 | |
| P40694 | |
| IGHMBP2 | |
| Synthetic peptides corresponding to Ighmbp2 (immunoglobulin mu binding protein 2) The peptide sequence was selected from the N terminal of Ighmbp2. Peptide sequence QLLELERDAEVEERRSWQEHSSLRELQSRGVCLLKLQVSSQRTGLYGQRL. | |
| Affinity Purified | |
| RUO | |
| 3508 | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| PBS & 2% Sucrose. with No Preservative | |
| ATP-dependent helicase IGHMBP2, CATF1FLJ41171, EC 3.6.1, EC 3.6.4.12, EC 3.6.4.13, GF-1, Glial factor 1, HCSA, HMN6cardiac transcription factor 1, immunoglobulin mu binding protein 2, Immunoglobulin mu-binding protein 2, SMARD1DNA-binding protein SMUBP-2, SMBP2, SMUBP2FLJ34220 | |
| Rabbit | |
| 109 kDa | |
| 20 μL | |
| Primary | |
| Mouse | |
| IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title