IGSF1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP214119

Catalog No. NBP214119

Description

IGSF1 Polyclonal specifically detects IGSF1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: IGSF1
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: IGDC1Pituitary gland-specific factor 2, IgSF1, immunoglobulin superfamily member 1, immunoglobulin superfamily, member 1, Immunoglobulin-like domain-containing protein 1, InhBP, Inhibin-binding protein, KIAA0364p120, MGC75490, PGSF2IGCD1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 3547
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: IGSF1
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: IVMPTPKPELWAETNFPLAPWKNLTLWCRSPSGSTKEFVLLKDGTGWIATRPASEQVRAAFPLGALTQSHTGSYHCHSWEEMAVSEPSE
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only