IGSF1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159245

Catalog No. NBP159245

Description

IGSF1 Polyclonal specifically detects IGSF1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: IGSF1
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: IGDC1Pituitary gland-specific factor 2, IgSF1, immunoglobulin superfamily member 1, immunoglobulin superfamily, member 1, Immunoglobulin-like domain-containing protein 1, InhBP, Inhibin-binding protein, KIAA0364p120, MGC75490, PGSF2IGCD1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 3547
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS & 2% Sucrose. with 0.09% Sodium Azide
• Gene Symbols: IGSF1
• Immunogen: Synthetic peptides corresponding to IGSF1(immunoglobulin superfamily, member 1) The peptide sequence was selected from the N terminal of IGSF1. Peptide sequence WLLARPSAVVQMGQNVSLRCRGPVDGVGLALYKKGEDKPLQFLDATSIDD.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%Rat: 92%; Mouse: 92%;.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG