IGSF4B/SynCAM3/CADM3 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP179320

Catalog No. NBP179320

Description

IGSF4B/SynCAM3/CADM3 Polyclonal specifically detects IGSF4B/SynCAM3/CADM3 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: IGSF4B/SynCAM3/CADM3
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_067012
• Gene Symbols: CADM3
• Immunogen: Synthetic peptide directed towards the middle region of human CADM3The immunogen for this antibody is CADM3. Peptide sequence KDTATLNCQSSGSKPAARLTWRKGDQELHGEPTRIQEDPNGKTFTVSSSV.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Guinea pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Canine: 92%; Equine: 92%; Pig: 92%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: BIgR, Brain immunoglobulin receptor, cell adhesion molecule 3, IgSF4B, IGSF4BSynCAM3, Immunoglobulin superfamily member 4B, member 4B, NECL-1, NECL1TSLC1-like protein 1, Nectin-like protein 1, Synaptic cell adhesion molecule 3, synCAM3, TSLC1-like 1, TSLL1SYNCAM3
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 57863
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.