Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
IL-17RE Mouse anti-Human, Janelia Fluor 646, Clone: 46N7E3, Novus Biologicals
Mouse Monoclonal Antibody
Manufacturer: Novus Biologicals NBP227367JF646
Description
IL-17RE Monoclonal antibody specifically detects IL-17RE in Human samples. It is validated for Western Blot, Immunohistochemistry (Paraffin).Specifications
IL-17RE | |
46N7E3 | |
Western Blot, Immunohistochemistry-Paraffin | |
Conjugated, Purified | |
IL17RE | |
amino acids (97-199) MVHLLVQkSkkSSTFkFYRRHkMPAPAQRkLLPRRHLSEkSHHISIPSPDISHkGLRSkR∽TQPSDPETWESLPRLDSQRHGGPEFSFDLLPEARAIRVTISSGPE | |
Protein G purified | |
Store at 4°C in the dark. | |
Monoclonal | |
Human |
Immunohistochemistry (Paraffin), Western Blot | |
Janelia Fluor 646 | |
50mM Sodium Borate with 0.05% Sodium Azide | |
IL-17 receptor E, interleukin 17 receptor E | |
Mouse | |
IgG2b Kappa | |
0.1 mL | |
Primary | |
132014.0 |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title