Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

IL-17RE Mouse anti-Human, Alexa Fluor™ 532, Clone: 46N8G7, Novus Biologicals™

Mouse Monoclonal Antibody

Manufacturer:  Novus BiologicalsSupplier Diversity Partner NBP227366AF532

Catalog No. NP227366A32


Add to cart

Description

Description

IL-17RE Monoclonal antibody specifically detects IL-17RE in Human samples. It is validated for Western Blot.
Specifications

Specifications

IL-17RE
46N8G7
Western Blot
IL-17 receptor E, interleukin 17 receptor E
Mouse
IgG1 Kappa
Store at 4°C in the dark.
Monoclonal
Human
Western Blot
Alexa Fluor™ 532
50 mM sodium borate with 0.05% sodium azide
IL17RE
amino acids (97-199) MVHLLVQkSkkSSTFkFYRRHkMPAPAQRkLLPRRHLSEkSHHISIPSPDISHkGLRSkR~TQPSDPETWESLPRLDSQRHGGPEFSFDLLPEARAIRVTISSGPE
0.1 mL
Primary
132014
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit